PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.Y2EMI
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family ARR-B
Protein Properties Length: 437aa    MW: 48933 Da    PI: 4.7537
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.Y2EMIgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like58.31.6e-18182233255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  +r+rWt  LH +F+eav    Gs  A Pk+i e m+v+g+t ehv S LQkYR 
  Araip.Y2EMI 182 KRIRWTDHLHMKFMEAVILA-GSG-AGPKKIHEYMNVPGVTKEHVSSYLQKYRQ 233
                  79***************755.766.9***************************6 PP

2Response_reg52.72.3e-18161201107
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHHESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEE CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekdpDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGakdf 97 
                   vl+vd + + + l  ++l+  gy ev +a+ g++al ++++++ +l+l+ i +p+m+ +el+ +ire+  ++p  +++a ++++   +al+ Gak +
   Araip.Y2EMI  16 VLVVDCDSTSLTLASKMLRILGY-EVVTAKLGSDALSIIEKNELHLVLMEIHLPDMKMFELIDKIRESY-DIPSFIMSADENQTSKSKALSKGAKLY 110
                   89*********************.*******************************************88.*************************** PP

                   EESS--HHHH CS
  Response_reg  98 lsKpfdpeel 107
                   + Kp   ++l
   Araip.Y2EMI 111 FIKPLLLSDL 120
                   ****876665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521728.82E-2412127IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23002.9E-2713125No hitNo description
SMARTSM004481.1E-1214124IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011029.92815128IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.5E-1416120IPR001789Signal transduction response regulator, receiver domain
CDDcd001565.18E-1817121No hitNo description
Gene3DG3DSA:1.10.10.609.7E-19179236IPR009057Homeodomain-like
SuperFamilySSF466891.08E-12179236IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-15182233IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MDYGNKYTIP TPGIKVLVVD CDSTSLTLAS KMLRILGYEV VTAKLGSDAL SIIEKNELHL  60
VLMEIHLPDM KMFELIDKIR ESYDIPSFIM SADENQTSKS KALSKGAKLY FIKPLLLSDL  120
KGLWKFASCN TKVSTVTTDQ NGSKSIIVNK DQECKPLNNN NNNNNKEKKQ ELVESSVVQR  180
RKRIRWTDHL HMKFMEAVIL AGSGAGPKKI HEYMNVPGVT KEHVSSYLQK YRQSLKAQDS  240
EIQYQRKILS SESNLGSYQS KDLFHCKSEQ FLDAPAHLPS TEIPTVHEPA LSQNQLLPGT  300
LVQGEMNGNG VESVISQEES YTDGRVSEED QLDPTEDFET MMTNTGSCFT SWSRLLDPEE  360
TSYEVSSKDY TAENSDLNRS MSMENDMCQQ FPAFPSVPSG NVDEIFNISK ETENASNKDS  420
EEATLTVEGI TLNDAVT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016186208.10.0PREDICTED: two-component response regulator ARR2
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1436288
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.13e-30response regulator 2